PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_018238-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family MYB
Protein Properties Length: 197aa    MW: 22854.8 Da    PI: 8.3337
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_018238-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.94.6e-181662248
                     SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +WT+eEd +l++ ++ +G  +Wk++a++ g++R++k+c++rw +yl
    NNU_018238-RA 16 AAWTAEEDRKLAQIIEVHGAQRWKSVAEKAGLNRSGKSCRLRWMNYL 62
                     68*******************************************97 PP

2Myb_DNA-binding50.83.8e-1668113148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+ + +E++l+++++k+lG++ W++Ia +++ gRt++++k++w+++l
    NNU_018238-RA  68 RGNISDQEEDLILRLHKLLGNR-WSLIAGRLP-GRTDNEIKNYWNSHL 113
                      78999*****************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129425.6981066IPR017930Myb domain
SuperFamilySSF466895.39E-2913109IPR009057Homeodomain-like
SMARTSM007179.0E-151464IPR001005SANT/Myb domain
PfamPF002494.3E-171662IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.2E-241769IPR009057Homeodomain-like
CDDcd001675.71E-111762No hitNo description
PROSITE profilePS5129420.66567117IPR017930Myb domain
SMARTSM007171.9E-1567115IPR001005SANT/Myb domain
PfamPF002491.6E-1468113IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.1E-2570118IPR009057Homeodomain-like
CDDcd001675.02E-1072113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 197 aa     Download sequence    Send to blast
MALMTDGPAK KELNRAAWTA EEDRKLAQII EVHGAQRWKS VAEKAGLNRS GKSCRLRWMN  60
YLRPNIKRGN ISDQEEDLIL RLHKLLGNRW SLIAGRLPGR TDNEIKNYWN SHLSKKVNQK  120
EILRTETTTC GFKRQRTCRD VEKDNLHVNE EGTWEGDVDS PTRLDVDEFL DFSTEGPFSL  180
EWVSKFSDFN ERLCGFS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-281211724128MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010273925.11e-145PREDICTED: transcription factor MYB114-like
SwissprotP102903e-50MYBC_MAIZE; Anthocyanin regulatory C1 protein
SwissprotQ962767e-51MYB23_ARATH; Transcription factor MYB23
TrEMBLA0A061GJK02e-84A0A061GJK0_THECC; Myb domain protein 23
STRINGVIT_09s0002g01380.t016e-82(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G40330.14e-52myb domain protein 23